Class a: All alpha proteins [46456] (258 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) |
Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
Protein Ribosomal protein S18 [46913] (1 species) |
Species Thermus thermophilus [TaxId:274] [46914] (38 PDB entries) |
Domain d2uubr1: 2uub R:19-88 [139949] Other proteins in same PDB: d2uubb1, d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uube2, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubp1, d2uubq1, d2uubs1, d2uubt1 automatically matched to 2J00 R:19-88 complexed with 6mz, cm0, k, mg, par, zn |
PDB Entry: 2uub (more details), 2.8 Å
SCOP Domain Sequences for d2uubr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uubr1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl lpfteklvrk
Timeline for d2uubr1: