Lineage for d2uubp1 (2uub P:1-83)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720771Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 720772Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 720773Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 720774Protein Ribosomal protein S16 [54567] (1 species)
  7. 720775Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
  8. 720786Domain d2uubp1: 2uub P:1-83 [139947]
    Other proteins in same PDB: d2uubb1, d2uubc1, d2uubc2, d2uubd1, d2uube1, d2uube2, d2uubf1, d2uubg1, d2uubh1, d2uubj1, d2uubk1, d2uubl1, d2uubm1, d2uubn1, d2uubo1, d2uubq1, d2uubr1, d2uubs1, d2uubt1
    automatically matched to d1emwa_
    complexed with 6mz, cm0, k, mg, par, zn

Details for d2uubp1

PDB Entry: 2uub (more details), 2.8 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOP Domain Sequences for d2uubp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uubp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d2uubp1:

Click to download the PDB-style file with coordinates for d2uubp1.
(The format of our PDB-style files is described here.)

Timeline for d2uubp1: