Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) |
Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
Protein Ribosomal protein S18 [46913] (2 species) |
Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries) Uniprot P80382 |
Domain d2uu9r1: 2uu9 R:19-88 [139909] Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9c2, d2uu9d1, d2uu9e1, d2uu9e2, d2uu9f1, d2uu9g1, d2uu9h1, d2uu9j1, d2uu9k1, d2uu9l1, d2uu9m1, d2uu9n1, d2uu9o1, d2uu9p1, d2uu9q1, d2uu9s1, d2uu9t1, d2uu9u1 automatically matched to 2J00 R:19-88 protein/RNA complex; complexed with k, mg, par, zn |
PDB Entry: 2uu9 (more details), 3.1 Å
SCOPe Domain Sequences for d2uu9r1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uu9r1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl lpfteklvrk
Timeline for d2uu9r1: