Lineage for d2uu9m1 (2uu9 M:2-126)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735301Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2735302Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2735303Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
    automatically mapped to Pfam PF00416
  6. 2735304Protein Ribosomal protein S13 [46948] (2 species)
  7. 2735332Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries)
    Uniprot P80377
  8. 2735353Domain d2uu9m1: 2uu9 M:2-126 [139904]
    Other proteins in same PDB: d2uu9b1, d2uu9c1, d2uu9c2, d2uu9d1, d2uu9e1, d2uu9e2, d2uu9f1, d2uu9g1, d2uu9h1, d2uu9j1, d2uu9k1, d2uu9l1, d2uu9n1, d2uu9o1, d2uu9p1, d2uu9q1, d2uu9r1, d2uu9s1, d2uu9t1, d2uu9u1
    automatically matched to d1fjgm_
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uu9m1

PDB Entry: 2uu9 (more details), 3.1 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
PDB Compounds: (M:) 30S ribosomal protein S13

SCOPe Domain Sequences for d2uu9m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uu9m1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOPe Domain Coordinates for d2uu9m1:

Click to download the PDB-style file with coordinates for d2uu9m1.
(The format of our PDB-style files is described here.)

Timeline for d2uu9m1: