Lineage for d2p9cb3 (2p9c B:327-410)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029255Superfamily d.58.18: ACT-like [55021] (14 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 1029256Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein)
  6. 1029257Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species)
  7. 1029258Species Escherichia coli [TaxId:562] [55024] (7 PDB entries)
  8. 1029270Domain d2p9cb3: 2p9c B:327-410 [139561]
    Other proteins in same PDB: d2p9ca1, d2p9ca2, d2p9cb1, d2p9cb2
    automatically matched to d1psda3
    complexed with nai, ser; mutant

Details for d2p9cb3

PDB Entry: 2p9c (more details), 2.46 Å

PDB Description: crystal structure of serine bound g336v mutant of e.coli phosphoglycerate dehydrogenase
PDB Compounds: (B:) D-3-phosphoglycerate dehydrogenase

SCOPe Domain Sequences for d2p9cb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9cb3 d.58.18.1 (B:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]}
fpevslplhvgrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead
edvaekalqamkaipgtirarlly

SCOPe Domain Coordinates for d2p9cb3:

Click to download the PDB-style file with coordinates for d2p9cb3.
(The format of our PDB-style files is described here.)

Timeline for d2p9cb3: