![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (14 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.1: Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55022] (1 protein) |
![]() | Protein Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain [55023] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [55024] (7 PDB entries) |
![]() | Domain d2p9cb3: 2p9c B:327-410 [139561] Other proteins in same PDB: d2p9ca1, d2p9ca2, d2p9cb1, d2p9cb2 automatically matched to d1psda3 complexed with nai, ser; mutant |
PDB Entry: 2p9c (more details), 2.46 Å
SCOPe Domain Sequences for d2p9cb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9cb3 d.58.18.1 (B:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} fpevslplhvgrrlmhihenrpgvltalnkifaeqgvniaaqylqtsaqmgyvvidiead edvaekalqamkaipgtirarlly
Timeline for d2p9cb3: