SCOPe 2.02: Domain d2oowb_: 2oow B:

Lineage for d2oowb_ (2oow B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.3: MIF-related [55339] (3 proteins)

6. Protein Microphage migration inhibition factor (MIF) [55340] (6 species)
   synonym: glycosylation-inhibiting factor (GIF)

7. Species Human (Homo sapiens) [TaxId:9606] [55341] (31 PDB entries)

8. Domain d2oowb_: 2oow B: [139198]
   automated match to d1gifa_
   complexed with gol, ipa, ox4, so4

Details for d2oowb_

PDB Entry: 2oow, 1.75 Å

PDB Description: mif bound to a fluorinated oxim derivative

PDB Compounds: (B:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d2oowb_:

Sequence; same for both SEQRES and ATOM records:

>d2oowb_ d.80.1.3 (B:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

Timeline for d2oowb_:

• d2oowb_ first appeared in SCOP 1.73, called d2oowb1
  
• d2oowb_ appears in SCOPe 2.01
  
• d2oowb_ appears in SCOPe 2.03
  
• d2oowb_ appears in the current release, SCOPe 2.08