PDB entry 2oow
View 2oow on RCSB PDB site
Description: MIF Bound to a Fluorinated OXIM Derivative
Class: isomerase
Keywords: alternative ligand-binding modes, ISOMERASE
Deposited on
2007-01-26, released
2007-06-05
The last revision prior to the SCOPe 2.02 freeze date was dated
2012-06-13, with a file datestamp of
2012-06-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.198
AEROSPACI score: 0.52
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: macrophage migration inhibitory factor
Species: Homo sapiens [TaxId:9606]
Gene: MIF
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2oowa_ - Chain 'B':
Compound: macrophage migration inhibitory factor
Species: Homo sapiens [TaxId:9606]
Gene: MIF
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2oowb_ - Chain 'C':
Compound: macrophage migration inhibitory factor
Species: Homo sapiens [TaxId:9606]
Gene: MIF
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2oowc_ - Heterogens: SO4, OX4, GOL, IPA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2oowA (A:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2oowB (B:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2oowC (C:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa