Lineage for d2ojed1 (2oje D:0-213)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1101567Fold a.202: Superantigen MAM [101343] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1101568Superfamily a.202.1: Superantigen MAM [101344] (1 family) (S)
  5. 1101569Family a.202.1.1: Superantigen MAM [101345] (2 proteins)
  6. 1101570Protein Superantigen MAM [101346] (1 species)
  7. 1101571Species Mycoplasma arthritidis [TaxId:2111] [101347] (3 PDB entries)
  8. 1101576Domain d2ojed1: 2oje D:0-213 [139107]
    Other proteins in same PDB: d2ojea1, d2ojea2, d2ojeb1, d2ojeb2, d2ojee1, d2ojee2, d2ojef1, d2ojef2
    automatically matched to d1r5id_
    complexed with po4

Details for d2ojed1

PDB Entry: 2oje (more details), 3 Å

PDB Description: Mycoplasma arthritidis-derived mitogen complexed with class II MHC molecule HLA-DR1/HA complex in the presence of EDTA
PDB Compounds: (D:) Superantigen

SCOPe Domain Sequences for d2ojed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ojed1 a.202.1.1 (D:0-213) Superantigen MAM {Mycoplasma arthritidis [TaxId: 2111]}
smklrvenpkkaqkhfvqnlnnvvftnkelediynlsnkeetkevlklfklkvnqfyrha
fgivndynglleykeifnmmflklsvvfdtqrkeannveqikrniaildeimakadndls
yfisqnknfqelwdkavkltkemkiklkgqkldlrdgevainkvrelfgsdknvkelwwf
rsllvkgvylikryyegdielkttsdfakavfed

SCOPe Domain Coordinates for d2ojed1:

Click to download the PDB-style file with coordinates for d2ojed1.
(The format of our PDB-style files is described here.)

Timeline for d2ojed1: