SCOPe 2.05: Domain d2nyyc2: 2nyy C:112-216

Lineage for d2nyyc2 (2nyy C:112-216)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d2nyyc2: 2nyy C:112-216 [138830]
   Other proteins in same PDB: d2nyya1, d2nyya2, d2nyya3, d2nyya4, d2nyyc1, d2nyyd1, d2nyyd2
   automated match to d1n0xl2
   complexed with ca, zn

Details for d2nyyc2

PDB Entry: 2nyy, 2.61 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody cr1

PDB Compounds: (C:) CR1 monoclonal antibody

SCOPe Domain Sequences for d2nyyc2:

Sequence; same for both SEQRES and ATOM records:

>d2nyyc2 b.1.1.2 (C:112-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d2nyyc2:

• d2nyyc2 first appeared in SCOP 1.73
  
• d2nyyc2 appears in SCOPe 2.04
  
• d2nyyc2 appears in SCOPe 2.06
  
• d2nyyc2 appears in the current release, SCOPe 2.08