SCOPe 2.05: Domain d2nyyc1: 2nyy C:1-111

Lineage for d2nyyc1 (2nyy C:1-111)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2nyyc1: 2nyy C:1-111 [138829]
   Other proteins in same PDB: d2nyya1, d2nyya2, d2nyya3, d2nyya4, d2nyyc2, d2nyyd1, d2nyyd2
   automated match to d1n0xl1
   complexed with ca, zn

Details for d2nyyc1

PDB Entry: 2nyy, 2.61 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody cr1

PDB Compounds: (C:) CR1 monoclonal antibody

SCOPe Domain Sequences for d2nyyc1:

Sequence; same for both SEQRES and ATOM records:

>d2nyyc1 b.1.1.0 (C:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratiscrasesvdsyghsfmqwyqqkpgqaprlliyrasnlep
giparfsgsgsgtdftltisslepedfavyycqqgnevpftfgqgtkveik

Timeline for d2nyyc1:

• d2nyyc1 first appeared in SCOP 1.73
  
• d2nyyc1 appears in SCOPe 2.04
  
• d2nyyc1 appears in SCOPe 2.06
  
• d2nyyc1 appears in the current release, SCOPe 2.08