SCOPe 2.02: Domain d2jhvc_: 2jhv C:

Lineage for d2jhvc_ (2jhv C:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49242] (11 PDB entries)

8. Domain d2jhvc_: 2jhv C: [138327]
   automated match to d1kmta_
   mutant

Details for d2jhvc_

PDB Entry: 2jhv, 2.07 Å

PDB Description: crystal structure of rhogdi e154a,e155a mutant

PDB Compounds: (C:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d2jhvc_:

Sequence; same for both SEQRES and ATOM records:

>d2jhvc_ b.1.18.8 (C:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw

Timeline for d2jhvc_:

• d2jhvc_ first appeared in SCOP 1.73, called d2jhvc1
  
• d2jhvc_ appears in SCOPe 2.01
  
• d2jhvc_ appears in SCOPe 2.03
  
• d2jhvc_ appears in the current release, SCOPe 2.08, called d2jhvc2