SCOP 1.73: Domain d2jhvc1: 2jhv C:65-202

Lineage for d2jhvc1 (2jhv C:65-202)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (2 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49242] (11 PDB entries)

8. Domain d2jhvc1: 2jhv C:65-202 [138327]
   automatically matched to d1kmta_
   mutant

Details for d2jhvc1

PDB Entry: 2jhv, 2.07 Å

PDB Description: crystal structure of rhogdi e154a,e155a mutant

PDB Compounds: (C:) rho GDP-dissociation inhibitor 1

SCOP Domain Sequences for d2jhvc1:

Sequence; same for both SEQRES and ATOM records:

>d2jhvc1 b.1.18.8 (C:65-202) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
amvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivs
gmkyiqhtyrkgvkidktdymvgsygpraaayefltpveeapkgmlargsysiksrftdd
dktdhlswewnltikkdw

Timeline for d2jhvc1:

• d2jhvc1 is new in SCOP 1.73
  
• d2jhvc1 appears in SCOP 1.75
  
• d2jhvc1 appears in the current release, SCOPe 2.08, called d2jhvc2