Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein automated matches [190332] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries) |
Domain d2j0sd_: 2j0s D: [137916] Other proteins in same PDB: d2j0sa1, d2j0sa2, d2j0sc_ automated match to d1p27b_ protein/DNA complex; protein/RNA complex; complexed with anp, mg |
PDB Entry: 2j0s (more details), 2.21 Å
SCOPe Domain Sequences for d2j0sd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0sd_ d.58.7.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyetyk eaqaameglngqdlmgqpisvdwcfvrgp
Timeline for d2j0sd_: