Lineage for d2j0sd_ (2j0s D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195506Protein automated matches [190332] (5 species)
    not a true protein
  7. 2195509Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)
  8. 2195545Domain d2j0sd_: 2j0s D: [137916]
    Other proteins in same PDB: d2j0sa1, d2j0sa2, d2j0sc_
    automated match to d1p27b_
    protein/DNA complex; protein/RNA complex; complexed with anp, mg

Details for d2j0sd_

PDB Entry: 2j0s (more details), 2.21 Å

PDB Description: the crystal structure of the exon junction complex at 2.2 a resolution
PDB Compounds: (D:) RNA-binding protein 8A

SCOPe Domain Sequences for d2j0sd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0sd_ d.58.7.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyetyk
eaqaameglngqdlmgqpisvdwcfvrgp

SCOPe Domain Coordinates for d2j0sd_:

Click to download the PDB-style file with coordinates for d2j0sd_.
(The format of our PDB-style files is described here.)

Timeline for d2j0sd_: