Lineage for d2ixqb1 (2ixq B:1-123)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767793Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
    Pfam PF04619
  6. 2767794Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 2767795Species Escherichia coli [TaxId:562] [110077] (11 PDB entries)
    Uniprot Q57254 P24093 23-159
  8. 2767841Domain d2ixqb1: 2ixq B:1-123 [137785]
    Other proteins in same PDB: d2ixqa1, d2ixqa2, d2ixqb2
    automatically matched to d1rxla_

Details for d2ixqb1

PDB Entry: 2ixq (more details)

PDB Description: the solution structure of the invasive tip complex from afa-dr fibrils
PDB Compounds: (B:) afimbrial adhesin afa-III

SCOPe Domain Sequences for d2ixqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ixqb1 b.2.3.6 (B:1-123) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
eecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalkadtdnfeqgkfflisdn
nrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgqqtntppgnytltltggy
wak

SCOPe Domain Coordinates for d2ixqb1:

Click to download the PDB-style file with coordinates for d2ixqb1.
(The format of our PDB-style files is described here.)

Timeline for d2ixqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ixqb2