SCOPe 2.08: Domain d2ik8c2: 2ik8 C:33-60,C:182-348

Lineage for d2ik8c2 (2ik8 C:33-60,C:182-348)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Human (Homo sapiens) [TaxId:9606] [159560] (9 PDB entries)

8. Domain d2ik8c2: 2ik8 C:33-60,C:182-348 [137487]
   Other proteins in same PDB: d2ik8a1, d2ik8b1, d2ik8c1, d2ik8d_
   automatically matched to d1kjya2
   complexed with alf, gdp, mg, so4
   has additional subdomain(s) that are not in the common domain

Details for d2ik8c2

PDB Entry: 2ik8, 2.71 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS16 and activated Gi alpha 1

PDB Compounds: (C:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2ik8c2:

Sequence; same for both SEQRES and ATOM records:

>d2ik8c2 c.37.1.8 (C:33-60,C:182-348) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
evkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkwi
hcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkkd
lfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtknv
qfvfdavtdviiknnl

Timeline for d2ik8c2:

• d2ik8c2 first appeared in SCOP 1.73
  
• d2ik8c2 appears in SCOPe 2.07