| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
| Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries) Uniprot P04229 30-219 probably orthologous to the mouse I-E group |
| Domain d2ianl1: 2ian L:93-190 [137172] Other proteins in same PDB: d2iana1, d2iana2, d2ianb2, d2ianf1, d2ianf2, d2iang2, d2iank1, d2iank2, d2ianl2, d2ianp1, d2ianp2, d2ianq2 automatically matched to d1d5xb1 mutant |
PDB Entry: 2ian (more details), 2.8 Å
SCOP Domain Sequences for d2ianl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ianl1 b.1.1.2 (L:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra
Timeline for d2ianl1: