Lineage for d2ianb2 (2ian B:3-92)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856861Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 856914Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (12 PDB entries)
  8. 856927Domain d2ianb2: 2ian B:3-92 [137165]
    Other proteins in same PDB: d2iana1, d2iana2, d2ianb1, d2ianf1, d2ianf2, d2iang1, d2iank1, d2iank2, d2ianl1, d2ianp1, d2ianp2, d2ianq1
    automatically matched to d1d5xb2
    mutant

Details for d2ianb2

PDB Entry: 2ian (more details), 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOP Domain Sequences for d2ianb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ianb2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d2ianb2:

Click to download the PDB-style file with coordinates for d2ianb2.
(The format of our PDB-style files is described here.)

Timeline for d2ianb2: