Lineage for d2ianp1 (2ian P:83-179)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784786Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 784836Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (26 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 784862Domain d2ianp1: 2ian P:83-179 [137174]
    Other proteins in same PDB: d2iana2, d2ianb1, d2ianb2, d2ianf2, d2iang1, d2iang2, d2iank2, d2ianl1, d2ianl2, d2ianp2, d2ianq1, d2ianq2
    automatically matched to d1k2da1
    mutant

Details for d2ianp1

PDB Entry: 2ian (more details), 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR
PDB Compounds: (P:) hla class II histocompatibility antigen, dr alpha chain

SCOP Domain Sequences for d2ianp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ianp1 b.1.1.2 (P:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwe

SCOP Domain Coordinates for d2ianp1:

Click to download the PDB-style file with coordinates for d2ianp1.
(The format of our PDB-style files is described here.)

Timeline for d2ianp1: