SCOPe 2.08: Domain d2i6gb2: 2i6g B:1-198

Lineage for d2i6gb2 (2i6g B:1-198)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.44: TehB-like [142603] (2 proteins)
   Pfam PF03848; overall structural similarity to Thiopurine S-methyltransferase (Pfam PF05724)

6. Protein Putative methyltransferase TehB [142604] (1 species)
   Tellurite resistance protein

7. Species Salmonella typhimurium [TaxId:90371] [142605] (1 PDB entry)
   Uniprot Q8ZPC3 1-198
   sequence similarity to Hypothetical methyltransferase PH1305 of the CAC2371-like family (117688)

8. Domain d2i6gb2: 2i6g B:1-198 [137097]
   Other proteins in same PDB: d2i6ga2, d2i6gb3
   automated match to d2i6ga1
   complexed with acy, cl, edo

Details for d2i6gb2

PDB Entry: 2i6g, 1.9 Å

PDB Description: crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution

PDB Compounds: (B:) Putative methyltransferase

SCOPe Domain Sequences for d2i6gb2:

Sequence; same for both SEQRES and ATOM records:

>d2i6gb2 c.66.1.44 (B:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]}
mtvrdenyftekygltrthsdvlaaakvvapgrtldlgcgngrnslylaangydvtawdk
npasmanlerikaaegldnlqtdlvdlntltfdgeydfilstvvmmfleaqtipglianm
qrctkpggynlivaamdtpdfpctvgfpfafkegelrryyegwdmlkynedvgelhrtde
ngnriklrfatmlarkta

Timeline for d2i6gb2:

• d2i6gb2 first appeared in SCOP 1.73, called d2i6gb1
  
• d2i6gb2 appears in SCOPe 2.07