PDB entry 2i6g

View 2i6g on RCSB PDB site
Description: Crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 A resolution
Class: transferase
Keywords: S-adenosyl-l-methionine-dependent methyltransferase fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, transferase
Deposited on 2006-08-28, released 2006-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative methyltransferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: 16420133
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZPC3 (1-198)
      • leader sequence (0)
      • modified residue (1)
      • see remark 999 (12)
      • see remark 999 (27)
      • see remark 999 (60)
      • modified residue (65)
      • see remark 999 (72)
      • modified residue (105-106)
      • modified residue (120)
      • see remark 999 (125)
      • modified residue (136)
      • see remark 999 (152)
      • modified residue (165)
      • see remark 999 (167)
      • see remark 999 (186)
      • modified residue (192)
      • see remark 999 (196)
    Domains in SCOPe 2.07: d2i6ga1, d2i6ga2
  • Chain 'B':
    Compound: Putative methyltransferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: 16420133
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZPC3 (1-198)
      • leader sequence (0)
      • modified residue (1)
      • see remark 999 (12)
      • see remark 999 (27)
      • see remark 999 (60)
      • modified residue (65)
      • see remark 999 (72)
      • modified residue (105-106)
      • modified residue (120)
      • see remark 999 (125)
      • modified residue (136)
      • see remark 999 (152)
      • modified residue (165)
      • see remark 999 (167)
      • see remark 999 (186)
      • modified residue (192)
      • see remark 999 (196)
    Domains in SCOPe 2.07: d2i6gb2, d2i6gb3
  • Heterogens: CL, EDO, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i6gA (A:)
    gmtvrdenyftekygltrthsdvlaaakvvapgrtldlgcgngrnslylaangydvtawd
    knpasmanlerikaaegldnlqtdlvdlntltfdgeydfilstvvmmfleaqtipglian
    mqrctkpggynlivaamdtpdfpctvgfpfafkegelrryyegwdmlkynedvgelhrtd
    engnriklrfatmlarkta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i6gA (A:)
    gmtvrdenyftekygltrthsdvlaaakvvapgrtldlgcgngrnslylaangydvtawd
    knpasmanlerikaaegldnlqtdlvdlntltfdgeydfilstvvmmfleaqtipglian
    mqrctkpggynlivaamdfpfafkegelrryyegwdmlkynedvgklrfatmlarkta
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i6gB (B:)
    gmtvrdenyftekygltrthsdvlaaakvvapgrtldlgcgngrnslylaangydvtawd
    knpasmanlerikaaegldnlqtdlvdlntltfdgeydfilstvvmmfleaqtipglian
    mqrctkpggynlivaamdtpdfpctvgfpfafkegelrryyegwdmlkynedvgelhrtd
    engnriklrfatmlarkta