Lineage for d2i1lb1 (2i1l B:459-589)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952099Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 952551Superfamily b.43.5: Riboflavin kinase-like [82114] (2 families) (S)
  5. 952552Family b.43.5.1: ATP-dependent riboflavin kinase-like [82115] (2 proteins)
  6. 952567Protein Riboflavin kinase domain of bifunctional FAD synthetase [101786] (1 species)
  7. 952568Species Thermotoga maritima [TaxId:2336] [101787] (6 PDB entries)
    Uniprot Q9WZW1
    TM0379
  8. 952578Domain d2i1lb1: 2i1l B:459-589 [136982]
    Other proteins in same PDB: d2i1la2, d2i1lb2
    automatically matched to d1mrzb1

Details for d2i1lb1

PDB Entry: 2i1l (more details), 2.5 Å

PDB Description: Crystal structure of the C2 form of FAD synthetase from Thermotoga maritima
PDB Compounds: (B:) Riboflavin kinase/FMN adenylyltransferase

SCOPe Domain Sequences for d2i1lb1:

Sequence, based on SEQRES records: (download)

>d2i1lb1 b.43.5.1 (B:459-589) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgf
rptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvksar
nmiddiinskf

Sequence, based on observed residues (ATOM records): (download)

>d2i1lb1 b.43.5.1 (B:459-589) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivhptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfnvkyevyildf
egdlygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskf

SCOPe Domain Coordinates for d2i1lb1:

Click to download the PDB-style file with coordinates for d2i1lb1.
(The format of our PDB-style files is described here.)

Timeline for d2i1lb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i1lb2