SCOPe 2.02: Domain d2i1lb1: 2i1l B:459-589

Lineage for d2i1lb1 (2i1l B:459-589)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.5: Riboflavin kinase-like [82114] (2 families)

5. Family b.43.5.1: ATP-dependent riboflavin kinase-like [82115] (2 proteins)

6. Protein Riboflavin kinase domain of bifunctional FAD synthetase [101786] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [101787] (6 PDB entries)
   Uniprot Q9WZW1
   TM0379

8. Domain d2i1lb1: 2i1l B:459-589 [136982]
   Other proteins in same PDB: d2i1la2, d2i1lb2
   automatically matched to d1mrzb1

Details for d2i1lb1

PDB Entry: 2i1l, 2.5 Å

PDB Description: Crystal structure of the C2 form of FAD synthetase from Thermotoga maritima

PDB Compounds: (B:) Riboflavin kinase/FMN adenylyltransferase

SCOPe Domain Sequences for d2i1lb1:

Sequence, based on SEQRES records:

>d2i1lb1 b.43.5.1 (B:459-589) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgf
rptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvksar
nmiddiinskf

Sequence, based on observed residues (ATOM records):

>d2i1lb1 b.43.5.1 (B:459-589) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
yfeiegivhptanidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfnvkyevyildf
egdlygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskf

Timeline for d2i1lb1:

• d2i1lb1 first appeared in SCOP 1.73
  
• d2i1lb1 appears in SCOPe 2.01
  
• d2i1lb1 appears in SCOPe 2.03
  
• d2i1lb1 appears in the current release, SCOPe 2.08