![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
![]() | Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
![]() | Protein P100 co-activator, SND1 [141207] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141208] (3 PDB entries) Uniprot Q7KZF4 705-794 |
![]() | Domain d2hqxb_: 2hqx B: [136676] automated match to d2hqxa1 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2hqx (more details), 1.42 Å
SCOPe Domain Sequences for d2hqxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hqxb_ b.34.9.1 (B:) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} tqfqklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfyi dygnrevlpstrlgtlspafstrvlpaqat
Timeline for d2hqxb_: