SCOPe 2.07: Domain d2hhhl1: 2hhh L:5-122

Lineage for d2hhhl1 (2hhh L:5-122)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S12 [50302] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50303] (36 PDB entries)
   Uniprot P17293

8. Domain d2hhhl1: 2hhh L:5-122 [136488]
   Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1
   automatically matched to d1i94l_
   complexed with ksg

Details for d2hhhl1

PDB Entry: 2hhh, 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit

PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d2hhhl1:

Sequence; same for both SEQRES and ATOM records:

>d2hhhl1 b.40.4.5 (L:5-122) Ribosomal protein S12 {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygt

Timeline for d2hhhl1:

• d2hhhl1 first appeared in SCOP 1.73
  
• d2hhhl1 appears in SCOPe 2.06
  
• d2hhhl1 appears in the current release, SCOPe 2.08