Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) |
Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
Protein Ribosomal protein S18 [46913] (2 species) |
Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries) Uniprot P80382 |
Domain d2hhhr1: 2hhh R:16-88 [136494] Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhs1, d2hhht1, d2hhhu1 automatically matched to d1i94r_ complexed with ksg |
PDB Entry: 2hhh (more details), 3.35 Å
SCOPe Domain Sequences for d2hhhr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhhr1 a.4.8.1 (R:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari lgllpfteklvrk
Timeline for d2hhhr1: