SCOPe 2.07: Domain d2hhhc2: 2hhh C:107-207

Lineage for d2hhhc2 (2hhh C:107-207)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)
   automatically mapped to Pfam PF00189

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
   Uniprot P80372

8. Domain d2hhhc2: 2hhh C:107-207 [136478]
   Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1
   automatically matched to d1fjgc2
   complexed with ksg

Details for d2hhhc2

PDB Entry: 2hhh, 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2hhhc2:

Sequence; same for both SEQRES and ATOM records:

>d2hhhc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

Timeline for d2hhhc2:

• d2hhhc2 first appeared in SCOP 1.73
  
• d2hhhc2 appears in SCOPe 2.06
  
• d2hhhc2 appears in the current release, SCOPe 2.08