Lineage for d2hgis1 (2hgi S:1-83)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1644888Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 1644889Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 1644890Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 1644891Protein Ribosomal protein S16 [54567] (3 species)
  7. 1644921Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
    Uniprot P80379
  8. 1644952Domain d2hgis1: 2hgi S:1-83 [136414]
    Other proteins in same PDB: d2hgie1, d2hgif1, d2hgif2, d2hgig1, d2hgih1, d2hgih2, d2hgii1, d2hgij1, d2hgik1, d2hgim1, d2hgin1, d2hgio1, d2hgip1, d2hgiq1, d2hgir1, d2hgit1, d2hgiu1, d2hgiv1, d2hgiw1, d2hgix1
    automatically matched to d1emwa_

Details for d2hgis1

PDB Entry: 2hgi (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGI contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGJ.
PDB Compounds: (S:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2hgis1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgis1 d.27.1.1 (S:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOPe Domain Coordinates for d2hgis1:

Click to download the PDB-style file with coordinates for d2hgis1.
(The format of our PDB-style files is described here.)

Timeline for d2hgis1: