Lineage for d2hgij1 (2hgi J:2-156)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495946Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1495947Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1495948Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1495949Protein Ribosomal protein S7 [47975] (4 species)
  7. 1495979Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 1496018Domain d2hgij1: 2hgi J:2-156 [136406]
    Other proteins in same PDB: d2hgie1, d2hgif1, d2hgif2, d2hgig1, d2hgih1, d2hgih2, d2hgii1, d2hgik1, d2hgim1, d2hgin1, d2hgio1, d2hgip1, d2hgiq1, d2hgir1, d2hgis1, d2hgit1, d2hgiu1, d2hgiv1, d2hgiw1, d2hgix1
    automatically matched to d1fjgg_

Details for d2hgij1

PDB Entry: 2hgi (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGI contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGJ.
PDB Compounds: (J:) 30S ribosomal protein S7

SCOPe Domain Sequences for d2hgij1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgij1 a.75.1.1 (J:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d2hgij1:

Click to download the PDB-style file with coordinates for d2hgij1.
(The format of our PDB-style files is described here.)

Timeline for d2hgij1: