Lineage for d2hgiv1 (2hgi V:2-81)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1644959Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 1644960Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
    automatically mapped to Pfam PF00203
  5. 1644961Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 1644962Protein Ribosomal protein S19 [54572] (2 species)
  7. 1644990Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
    Uniprot P80381
  8. 1645022Domain d2hgiv1: 2hgi V:2-81 [136417]
    Other proteins in same PDB: d2hgie1, d2hgif1, d2hgif2, d2hgig1, d2hgih1, d2hgih2, d2hgii1, d2hgij1, d2hgik1, d2hgim1, d2hgin1, d2hgio1, d2hgip1, d2hgiq1, d2hgir1, d2hgis1, d2hgit1, d2hgiu1, d2hgiw1, d2hgix1
    automatically matched to d1fjgs_

Details for d2hgiv1

PDB Entry: 2hgi (more details), 5 Å

PDB Description: Crystal structure of the 70S Thermus thermophilus ribosome showing how the 16S 3'-end mimicks mRNA E and P codons. This entry 2HGI contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGJ.
PDB Compounds: (V:) 30S ribosomal protein S19

SCOPe Domain Sequences for d2hgiv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgiv1 d.28.1.1 (V:2-81) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d2hgiv1:

Click to download the PDB-style file with coordinates for d2hgiv1.
(The format of our PDB-style files is described here.)

Timeline for d2hgiv1: