Class g: Small proteins [56992] (94 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.2: Nuclear receptor [57721] (13 proteins) duplication: two zinc-binding motifs |
Protein automated matches [190314] (3 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187128] (1 PDB entry) |
Domain d2hana_: 2han A: [136291] automated match to d1r0oa_ protein/DNA complex; complexed with zn |
PDB Entry: 2han (more details), 1.95 Å
SCOPe Domain Sequences for d2hana_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hana_ g.39.1.2 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} khlcsicgdrasgkhygvyscegckgffkrtvrkdltyacrenrnciidkrqrnrcqycr yqkcltcgmkreavqeer
Timeline for d2hana_: