SCOPe 2.05: Domain d2hana_: 2han A:

Lineage for d2hana_ (2han A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein automated matches [190314] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187128] (1 PDB entry)

8. Domain d2hana_: 2han A: [136291]
   automated match to d1r0oa_
   protein/DNA complex; complexed with zn

Details for d2hana_

PDB Entry: 2han, 1.95 Å

PDB Description: structural basis of heterodimeric ecdysteroid receptor interaction with natural response element hsp27 gene promoter

PDB Compounds: (A:) Protein ultraspiracle

SCOPe Domain Sequences for d2hana_:

Sequence; same for both SEQRES and ATOM records:

>d2hana_ g.39.1.2 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khlcsicgdrasgkhygvyscegckgffkrtvrkdltyacrenrnciidkrqrnrcqycr
yqkcltcgmkreavqeer

Timeline for d2hana_:

• d2hana_ first appeared in SCOP 1.73, called d2hana1
  
• d2hana_ appears in SCOPe 2.04
  
• d2hana_ appears in SCOPe 2.06
  
• d2hana_ appears in the current release, SCOPe 2.08