Lineage for d2h9ec_ (2h9e C:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1964270Fold g.22: Serine protease inhibitors [57566] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1964271Superfamily g.22.1: Serine protease inhibitors [57567] (2 families) (S)
  5. 1964272Family g.22.1.1: ATI-like [57568] (5 proteins)
    automatically mapped to Pfam PF01826
  6. 1964289Protein automated matches [190313] (1 species)
    not a true protein
  7. 1964290Species Dog hookworm (Ancylostoma caninum) [TaxId:29170] [187127] (1 PDB entry)
  8. 1964291Domain d2h9ec_: 2h9e C: [136254]
    Other proteins in same PDB: d2h9eh_, d2h9el1
    automated match to d1coua_
    complexed with act, na, po4

Details for d2h9ec_

PDB Entry: 2h9e (more details), 2.2 Å

PDB Description: crystal structure of fxa/selectide/napc2 ternary complex
PDB Compounds: (C:) Anti-coagulant protein C2

SCOPe Domain Sequences for d2h9ec_:

Sequence, based on SEQRES records: (download)

>d2h9ec_ g.22.1.1 (C:) automated matches {Dog hookworm (Ancylostoma caninum) [TaxId: 29170]}
cgenekydscgskecdkkckydgveeeddeepnvpclvrvchqdcvceegfyrnkddkcv
saedceldnmdfiypgtr

Sequence, based on observed residues (ATOM records): (download)

>d2h9ec_ g.22.1.1 (C:) automated matches {Dog hookworm (Ancylostoma caninum) [TaxId: 29170]}
cgenekyddkkckydgvecvceegfyrnkddkcvsaedceldnmdfiypgtr

SCOPe Domain Coordinates for d2h9ec_:

Click to download the PDB-style file with coordinates for d2h9ec_.
(The format of our PDB-style files is described here.)

Timeline for d2h9ec_: