Class g: Small proteins [56992] (94 folds) |
Fold g.22: Serine protease inhibitors [57566] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.22.1: Serine protease inhibitors [57567] (2 families) |
Family g.22.1.1: ATI-like [57568] (5 proteins) automatically mapped to Pfam PF01826 |
Protein automated matches [190313] (1 species) not a true protein |
Species Dog hookworm (Ancylostoma caninum) [TaxId:29170] [187127] (1 PDB entry) |
Domain d2h9ec_: 2h9e C: [136254] Other proteins in same PDB: d2h9eh_, d2h9el1 automated match to d1coua_ complexed with act, na, po4 |
PDB Entry: 2h9e (more details), 2.2 Å
SCOPe Domain Sequences for d2h9ec_:
Sequence, based on SEQRES records: (download)
>d2h9ec_ g.22.1.1 (C:) automated matches {Dog hookworm (Ancylostoma caninum) [TaxId: 29170]} cgenekydscgskecdkkckydgveeeddeepnvpclvrvchqdcvceegfyrnkddkcv saedceldnmdfiypgtr
>d2h9ec_ g.22.1.1 (C:) automated matches {Dog hookworm (Ancylostoma caninum) [TaxId: 29170]} cgenekyddkkckydgvecvceegfyrnkddkcvsaedceldnmdfiypgtr
Timeline for d2h9ec_: