Lineage for d2h1lk_ (2h1l K:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870969Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2871234Protein Papillomavirus large T antigen helicase domain [89688] (1 species)
  7. 2871235Species Simian virus 40 [TaxId:10633] [89689] (5 PDB entries)
    Uniprot P03070 265-627
  8. 2871259Domain d2h1lk_: 2h1l K: [135957]
    Other proteins in same PDB: d2h1lm2, d2h1lm3, d2h1ln2, d2h1ln3, d2h1lo2, d2h1lo3, d2h1lp2, d2h1lp3, d2h1lq2, d2h1lq3, d2h1lr2, d2h1lr3, d2h1ls2, d2h1ls3, d2h1lt2, d2h1lt3, d2h1lu2, d2h1lu3, d2h1lv2, d2h1lv3, d2h1lw2, d2h1lw3, d2h1lx2, d2h1lx3
    automated match to d1svmc_
    complexed with zn

    has additional subdomain(s) that are not in the common domain

Details for d2h1lk_

PDB Entry: 2h1l (more details), 3.16 Å

PDB Description: the structure of the oncoprotein sv40 large t antigen and p53 tumor suppressor complex
PDB Compounds: (K:) large t antigen

SCOPe Domain Sequences for d2h1lk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1lk_ c.37.1.20 (K:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}
kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
ld

SCOPe Domain Coordinates for d2h1lk_:

Click to download the PDB-style file with coordinates for d2h1lk_.
(The format of our PDB-style files is described here.)

Timeline for d2h1lk_: