Lineage for d2gc7a_ (2gc7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808749Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 2808785Family b.69.2.0: automated matches [232760] (1 protein)
    not a true family
  6. 2808786Protein automated matches [232762] (1 species)
    not a true protein
  7. 2808787Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries)
  8. 2808812Domain d2gc7a_: 2gc7 A: [134954]
    Other proteins in same PDB: d2gc7b_, d2gc7c_, d2gc7d_, d2gc7f_, d2gc7g_, d2gc7h_, d2gc7j_, d2gc7k_, d2gc7l_, d2gc7n_, d2gc7o_, d2gc7p_
    automated match to d3l4od_
    complexed with hec, na

Details for d2gc7a_

PDB Entry: 2gc7 (more details), 1.9 Å

PDB Description: substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
PDB Compounds: (A:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d2gc7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc7a_ b.69.2.0 (A:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvi
dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
eelrsvnqlghgpqvittadmg

SCOPe Domain Coordinates for d2gc7a_:

Click to download the PDB-style file with coordinates for d2gc7a_.
(The format of our PDB-style files is described here.)

Timeline for d2gc7a_: