Lineage for d2fjva_ (2fjv A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016821Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 3017271Protein MMLV reverse transcriptase [56687] (1 species)
  7. 3017272Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries)
    Uniprot P03355 RE 144-594
  8. 3017278Domain d2fjva_: 2fjv A: [133623]
    automated match to d1d0eb_
    protein/DNA complex; complexed with hxl
    fragment; missing more than one-third of the common structure and/or sequence

Details for d2fjva_

PDB Entry: 2fjv (more details), 2.05 Å

PDB Description: rt29 bound to d(cttaattcgaattaag) in complex with mmlv rt catalytic fragment
PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d2fjva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjva_ e.8.1.2 (A:) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllkegqr

SCOPe Domain Coordinates for d2fjva_:

Click to download the PDB-style file with coordinates for d2fjva_.
(The format of our PDB-style files is described here.)

Timeline for d2fjva_: