Lineage for d2f2ab2 (2f2a B:4-293)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1925709Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1925710Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 1925962Family d.128.1.5: GatB/GatE catalytic domain-like [143812] (2 proteins)
    N-terminal and C-terminal parts correspond to Pfam PF02934 (GatB_N) and Pfam PF01162 (GatB), respectively
  6. 1925963Protein Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, N-terminal domain [143813] (1 species)
  7. 1925964Species Staphylococcus aureus [TaxId:1280] [143814] (5 PDB entries)
    Uniprot P64201 2-293
  8. 1925965Domain d2f2ab2: 2f2a B:4-293 [132803]
    Other proteins in same PDB: d2f2aa_, d2f2ab1, d2f2ac_
    automated match to d2df4b2
    protein/RNA complex; complexed with gln, mg

Details for d2f2ab2

PDB Entry: 2f2a (more details), 2.3 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB complexed with Gln
PDB Compounds: (B:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B

SCOPe Domain Sequences for d2f2ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2ab2 d.128.1.5 (B:4-293) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
etviglevhvelktdskmfspspahfgaepnsntnvidlaypgvlpvvnkravdwamraa
malnmeiateskfdrknyfypdnpkayqisqfdqpigengyidievdgetkrigitrlhm
eedagksthkgeyslvdlnrqgtplieivsepdirspkeayayleklrsiiqytgvsdvk
meegslrcdanislrpygqekfgtkaelknlnsfnyvrkgleyeekrqeeellnggeigq
etrrfdestgktilmrvkegsddyryfpepdivplyiddawkervrqtip

SCOPe Domain Coordinates for d2f2ab2:

Click to download the PDB-style file with coordinates for d2f2ab2.
(The format of our PDB-style files is described here.)

Timeline for d2f2ab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f2ab1