Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) form homo and heterodimers |
Family d.74.3.2: RBP11/RpoL [64311] (4 proteins) |
Protein RPB11 [64312] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries) Uniprot P38902; part of multichain biological unit |
Domain d2e2jk1: 2e2j K:1-114 [132018] Other proteins in same PDB: d2e2ja1, d2e2jb1, d2e2jc1, d2e2jc2, d2e2je1, d2e2je2, d2e2jf1, d2e2jh1, d2e2ji1, d2e2ji2, d2e2jj1, d2e2jl1 automatically matched to d1i3qk_ protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn |
PDB Entry: 2e2j (more details), 3.5 Å
SCOPe Domain Sequences for d2e2jk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e2jk1 d.74.3.2 (K:1-114) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
Timeline for d2e2jk1: