Lineage for d2e2jc2 (2e2j C:42-172)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2610858Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 2610859Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 2610860Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)
  6. 2610940Protein RPB3 [64462] (2 species)
  7. 2610941Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 2610955Domain d2e2jc2: 2e2j C:42-172 [132010]
    Other proteins in same PDB: d2e2ja1, d2e2jb1, d2e2jc1, d2e2je1, d2e2je2, d2e2jf1, d2e2jh1, d2e2ji1, d2e2ji2, d2e2jj1, d2e2jk1, d2e2jl1
    automatically matched to d1i3qc2
    protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn

Details for d2e2jc2

PDB Entry: 2e2j (more details), 3.5 Å

PDB Description: rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2e2jc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2jc2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

SCOPe Domain Coordinates for d2e2jc2:

Click to download the PDB-style file with coordinates for d2e2jc2.
(The format of our PDB-style files is described here.)

Timeline for d2e2jc2: