SCOPe 2.07: Domain d2e2jf1: 2e2j F:72-154

Lineage for d2e2jf1 (2e2j F:72-154)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.2: RPB6 [55294] (2 proteins)

6. Protein RPB6 [55295] (3 species)
   essential subunit of RNA polymerases I, II and III

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries)
   Uniprot P20435; part of multichain biological unit

8. Domain d2e2jf1: 2e2j F:72-154 [132013]
   Other proteins in same PDB: d2e2ja1, d2e2jb1, d2e2jc1, d2e2jc2, d2e2je1, d2e2je2, d2e2jh1, d2e2ji1, d2e2ji2, d2e2jj1, d2e2jk1, d2e2jl1
   automatically matched to d1i3qf_
   protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn

Details for d2e2jf1

PDB Entry: 2e2j, 3.5 Å

PDB Description: rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d2e2jf1:

Sequence; same for both SEQRES and ATOM records:

>d2e2jf1 a.143.1.2 (F:72-154) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivd

Timeline for d2e2jf1:

• d2e2jf1 first appeared in SCOP 1.73
  
• d2e2jf1 appears in SCOPe 2.06
  
• d2e2jf1 appears in the current release, SCOPe 2.08