Class a: All alpha proteins [46456] (284 folds) |
Fold a.182: GatB/YqeY motif [89094] (1 superfamily) multihelical; consists of two different alpha-helical bundles (4-helical and 3-helical) |
Superfamily a.182.1: GatB/YqeY motif [89095] (2 families) |
Family a.182.1.2: GatB/GatE C-terminal domain-like [140757] (2 proteins) assigned to the same Pfam PF02637 family as YeqY by the presence of a common sequence motif with an alpha-hairpin structure |
Protein Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, C-terminal domain [140758] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [140759] (5 PDB entries) Uniprot P64201 294-400 |
Domain d2df4b1: 2df4 B:294-400 [131446] Other proteins in same PDB: d2df4a1, d2df4b2, d2df4c1 protein/RNA complex; complexed with mn |
PDB Entry: 2df4 (more details), 3.2 Å
SCOPe Domain Sequences for d2df4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2df4b1 a.182.1.2 (B:294-400) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, C-terminal domain {Staphylococcus aureus [TaxId: 1280]} elpderkakyvnelglpaydahvltltkemsdffestiehgadvkltsnwlmggvneyln knqvelldtkltpenlagmikliedgtmsskiakkvfpelaakggna
Timeline for d2df4b1: