Lineage for d2df4b1 (2df4 B:294-400)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650772Fold a.182: GatB/YqeY motif [89094] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles (4-helical and 3-helical)
  4. 650773Superfamily a.182.1: GatB/YqeY motif [89095] (2 families) (S)
  5. 650778Family a.182.1.2: GatB/GatE C-terminal domain-like [140757] (2 proteins)
    assigned to the same Pfam PF02637 family as YeqY by the presence of a common sequence motif with an alpha-hairpin structure
  6. 650779Protein Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, C-terminal domain [140758] (1 species)
  7. 650780Species Staphylococcus aureus [TaxId:1280] [140759] (5 PDB entries)
  8. 650784Domain d2df4b1: 2df4 B:294-400 [131446]
    Other proteins in same PDB: d2df4a1, d2df4b2, d2df4c1
    complexed with mn

Details for d2df4b1

PDB Entry: 2df4 (more details), 3.2 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB complexed with Mn2+
PDB Compounds: (B:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B

SCOP Domain Sequences for d2df4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2df4b1 a.182.1.2 (B:294-400) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
elpderkakyvnelglpaydahvltltkemsdffestiehgadvkltsnwlmggvneyln
knqvelldtkltpenlagmikliedgtmsskiakkvfpelaakggna

SCOP Domain Coordinates for d2df4b1:

Click to download the PDB-style file with coordinates for d2df4b1.
(The format of our PDB-style files is described here.)

Timeline for d2df4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2df4b2