SCOPe 2.08: Domain d2dcye_: 2dcy E:

Lineage for d2dcye_ (2dcy E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (21 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus subtilis [TaxId:1423] [49981] (3 PDB entries)

8. Domain d2dcye_: 2dcy E: [131392]
   automated match to d2dcya1
   complexed with dio, tar, tla

Details for d2dcye_

PDB Entry: 2dcy, 1.4 Å

PDB Description: crystal structure of bacillus subtilis family-11 xylanase

PDB Compounds: (E:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d2dcye_:

Sequence; same for both SEQRES and ATOM records:

>d2dcye_ b.29.1.11 (E:) Xylanase II {Bacillus subtilis [TaxId: 1423]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

Timeline for d2dcye_:

• d2dcye_ first appeared in SCOP 1.73, called d2dcye1
  
• d2dcye_ appears in SCOPe 2.07