SCOPe 2.02: Domain d2cv5g_: 2cv5 G:

Lineage for d2cv5g_ (2cv5 G:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (6 species)

7. Species Human (Homo sapiens), H2A.a [TaxId:9606] [140392] (1 PDB entry)
   Uniprot P28001 11-118

8. Domain d2cv5g_: 2cv5 G: [130853]
   Other proteins in same PDB: d2cv5a_, d2cv5b_, d2cv5d1, d2cv5e_, d2cv5f_, d2cv5h_
   automated match to d1kx5c_
   protein/DNA complex; complexed with cl, mn

Details for d2cv5g_

PDB Entry: 2cv5, 2.5 Å

PDB Description: Crystal structure of human nucleosome core particle

PDB Compounds: (G:) Histone H2A.a

SCOPe Domain Sequences for d2cv5g_:

Sequence; same for both SEQRES and ATOM records:

>d2cv5g_ a.22.1.1 (G:) Histone H2A {Human (Homo sapiens), H2A.a [TaxId: 9606]}
ktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk

Timeline for d2cv5g_:

• d2cv5g_ first appeared in SCOP 1.73, called d2cv5g1
  
• d2cv5g_ was called d2cv5g1 in SCOPe 2.01
  
• d2cv5g_ appears in SCOPe 2.03
  
• d2cv5g_ appears in the current release, SCOPe 2.08