Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
Protein Class alpha GST [81360] (8 species) |
Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89704] (8 PDB entries) |
Domain d2c80a2: 2c80 A:4-84 [130090] Other proteins in same PDB: d2c80a1, d2c80b1 automatically matched to d1oe8b2 complexed with gtx, pg4 |
PDB Entry: 2c80 (more details), 2.3 Å
SCOPe Domain Sequences for d2c80a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c80a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} dhikviyfngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg hvkwmveslaiarymakkhhm
Timeline for d2c80a2: