Lineage for d2c57l_ (2c57 L:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1588434Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1588435Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 1588548Protein automated matches [190071] (5 species)
    not a true protein
  7. 1588551Species Helicobacter pylori [TaxId:210] [187015] (7 PDB entries)
  8. 1588578Domain d2c57l_: 2c57 L: [129890]
    automated match to d4b6ra_
    complexed with fa1

Details for d2c57l_

PDB Entry: 2c57 (more details), 3.1 Å

PDB Description: h.pylori type ii dehydroquinase in complex with fa1
PDB Compounds: (L:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2c57l_:

Sequence, based on SEQRES records: (download)

>d2c57l_ c.23.13.1 (L:) automated matches {Helicobacter pylori [TaxId: 210]}
mkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffqtnfegeiid
kiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytga
acggvimgfgplgynmalmamvnilaemkafqeaqknn

Sequence, based on observed residues (ATOM records): (download)

>d2c57l_ c.23.13.1 (L:) automated matches {Helicobacter pylori [TaxId: 210]}
mkilviqgpnlnmlghrgmvtldqiheimqtfvkqgnldveleffqtnfegeiidkiqes
vgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytgaacggv
imgfgplgynmalmamvnilaemkafqeaqknn

SCOPe Domain Coordinates for d2c57l_:

Click to download the PDB-style file with coordinates for d2c57l_.
(The format of our PDB-style files is described here.)

Timeline for d2c57l_: