SCOPe 2.04: Structural Classification of Proteins

PDB entry 2c57

View 2c57 on RCSB PDB site
Description: h.pylori type II dehydroquinase in complex with fa1
Class: lyase
Keywords: dehydroquinase, dehydroquinate, sulphonamide, lyase, 3-dehydroquinase, shikimate pathway, aromatic amino acid biosynthesis
Deposited on 2005-10-26, released 2006-02-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.21
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: 3-dehydroquinate dehydratase
Species: Helicobacter pylori [TaxId:210]
Database cross-references and differences (RAF-indexed):
- PDB 2C57 (11-12)
- Uniprot Q48255 (13-End)
Domains in SCOPe 2.04: d2c57a_
Chain 'B':
Compound: 3-dehydroquinate dehydratase
Species: Helicobacter pylori [TaxId:210]
Database cross-references and differences (RAF-indexed):
- PDB 2C57
- Uniprot Q48255 (13-End)
Domains in SCOPe 2.04: d2c57b_
Chain 'C':
Compound: 3-dehydroquinate dehydratase
Species: Helicobacter pylori [TaxId:210]
Database cross-references and differences (RAF-indexed):
- PDB 2C57
- Uniprot Q48255 (13-End)
Domains in SCOPe 2.04: d2c57c_
Chain 'D':
Compound: 3-dehydroquinate dehydratase
Species: Helicobacter pylori [TaxId:210]
Database cross-references and differences (RAF-indexed):
- PDB 2C57 (11-12)
- Uniprot Q48255 (13-End)
Domains in SCOPe 2.04: d2c57d_
Chain 'E':
Compound: 3-dehydroquinate dehydratase
Species: Helicobacter pylori [TaxId:210]
Database cross-references and differences (RAF-indexed):
- PDB 2C57
- Uniprot Q48255 (13-End)
Domains in SCOPe 2.04: d2c57e_
Chain 'F':
Compound: 3-dehydroquinate dehydratase
Species: Helicobacter pylori [TaxId:210]
Database cross-references and differences (RAF-indexed):
- PDB 2C57
- Uniprot Q48255 (13-End)
Domains in SCOPe 2.04: d2c57f_
Chain 'G':
Compound: 3-dehydroquinate dehydratase
Species: Helicobacter pylori [TaxId:210]
Database cross-references and differences (RAF-indexed):
- PDB 2C57 (11-12)
- Uniprot Q48255 (13-End)
Domains in SCOPe 2.04: d2c57g_
Chain 'H':
Compound: 3-dehydroquinate dehydratase
Species: Helicobacter pylori [TaxId:210]
Database cross-references and differences (RAF-indexed):
- PDB 2C57
- Uniprot Q48255 (13-End)
Domains in SCOPe 2.04: d2c57h_
Chain 'I':
Compound: 3-dehydroquinate dehydratase
Species: Helicobacter pylori [TaxId:210]
Database cross-references and differences (RAF-indexed):
- PDB 2C57
- Uniprot Q48255 (13-End)
Domains in SCOPe 2.04: d2c57i_
Chain 'J':
Compound: 3-dehydroquinate dehydratase
Species: Helicobacter pylori [TaxId:210]
Database cross-references and differences (RAF-indexed):
- PDB 2C57 (11-12)
- Uniprot Q48255 (13-End)
Domains in SCOPe 2.04: d2c57j_
Chain 'K':
Compound: 3-dehydroquinate dehydratase
Species: Helicobacter pylori [TaxId:210]
Database cross-references and differences (RAF-indexed):
- PDB 2C57
- Uniprot Q48255 (13-End)
Domains in SCOPe 2.04: d2c57k_
Chain 'L':
Compound: 3-dehydroquinate dehydratase
Species: Helicobacter pylori [TaxId:210]
Database cross-references and differences (RAF-indexed):
- PDB 2C57
- Uniprot Q48255 (13-End)
Domains in SCOPe 2.04: d2c57l_
Heterogens: FA1

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2c57A (A:)
gsshhhhhhssshmkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldvel
effqtnfegeiidkiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniq
areefrknsytgaacggvimgfgplgynmalmamvnilaemkafqeaqknnpnnpinnqk