Lineage for d2c57l1 (2c57 L:1-158)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1357747Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1357748Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 1357749Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)
  7. 1357788Species Helicobacter pylori [TaxId:210] [89598] (2 PDB entries)
  8. 1357801Domain d2c57l1: 2c57 L:1-158 [129890]
    automatically matched to d1j2ya_
    complexed with fa1

Details for d2c57l1

PDB Entry: 2c57 (more details), 3.1 Å

PDB Description: h.pylori type ii dehydroquinase in complex with fa1
PDB Compounds: (L:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2c57l1:

Sequence, based on SEQRES records: (download)

>d2c57l1 c.23.13.1 (L:1-158) Type II 3-dehydroquinate dehydratase {Helicobacter pylori [TaxId: 210]}
mkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffqtnfegeiid
kiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytga
acggvimgfgplgynmalmamvnilaemkafqeaqknn

Sequence, based on observed residues (ATOM records): (download)

>d2c57l1 c.23.13.1 (L:1-158) Type II 3-dehydroquinate dehydratase {Helicobacter pylori [TaxId: 210]}
mkilviqgpnlnmlghrgmvtldqiheimqtfvkqgnldveleffqtnfegeiidkiqes
vgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytgaacggv
imgfgplgynmalmamvnilaemkafqeaqknn

SCOPe Domain Coordinates for d2c57l1:

Click to download the PDB-style file with coordinates for d2c57l1.
(The format of our PDB-style files is described here.)

Timeline for d2c57l1: