Lineage for d2bwbb_ (2bwb B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1081233Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1081257Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 1081258Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1081364Protein automated matches [190533] (2 species)
    not a true protein
  7. 1081365Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187496] (1 PDB entry)
  8. 1081367Domain d2bwbb_: 2bwb B: [129330]
    automated match to d1wr1b1

Details for d2bwbb_

PDB Entry: 2bwb (more details), 2.3 Å

PDB Description: crystal structure of the uba domain of dsk2 from s. cerevisiae
PDB Compounds: (B:) ubiquitin-like protein dsk2

SCOPe Domain Sequences for d2bwbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwbb_ a.5.2.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldslln

SCOPe Domain Coordinates for d2bwbb_:

Click to download the PDB-style file with coordinates for d2bwbb_.
(The format of our PDB-style files is described here.)

Timeline for d2bwbb_: