SCOPe 2.02: Domain d2bwbc_: 2bwb C:

Lineage for d2bwbc_ (2bwb C:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (4 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein automated matches [190533] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187496] (1 PDB entry)

8. Domain d2bwbc_: 2bwb C: [129331]
   automated match to d1wr1b1

Details for d2bwbc_

PDB Entry: 2bwb, 2.3 Å

PDB Description: crystal structure of the uba domain of dsk2 from s. cerevisiae

PDB Compounds: (C:) ubiquitin-like protein dsk2

SCOPe Domain Sequences for d2bwbc_:

Sequence; same for both SEQRES and ATOM records:

>d2bwbc_ a.5.2.1 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng

Timeline for d2bwbc_:

• d2bwbc_ first appeared in SCOP 1.73, called d2bwbc1
  
• d2bwbc_ appears in SCOPe 2.01
  
• d2bwbc_ appears in SCOPe 2.03
  
• d2bwbc_ appears in the current release, SCOPe 2.08